PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_10039_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family TALE
Protein Properties Length: 342aa    MW: 38742.1 Da    PI: 7.131
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_10039_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.61.2e-091361731954
                                           HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                              Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                                           Fe   ++yp+ +e+  LA+++gL+ +qV +WF N R +
  cra_locus_10039_iso_1_len_1385_ver_3 136 FEHflHPYPKDSEKIMLARQTGLSRSQVANWFINARVR 173
                                           664559******************************88 PP

2BELL82.94.1e-2717741572
                                  BELL 15 lleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72
                                          +l    +rY+qy++q+q+v+ssFe+vag g+a+ Yt+lAl++iS +FrcL+dai++qi
  cra_locus_10039_iso_1_len_1385_ver_3 17 MLTLGGRRYRQYNQQMQVVASSFEIVAGRGAARRYTALALRTISCQFRCLRDAIKKQI 74
                                          6666679**************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005748.9E-5172IPR006563POX domain
PfamPF075267.9E-231170IPR006563POX domain
PROSITE profilePS5007112.276114177IPR001356Homeobox domain
CDDcd000867.14E-12117178No hitNo description
SMARTSM003894.4E-10117181IPR001356Homeobox domain
SuperFamilySSF466894.9E-18118184IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-28120183IPR009057Homeodomain-like
PfamPF059205.6E-18134173IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
XNANQEEVDE NSVVYNMLTL GGRRYRQYNQ QMQVVASSFE IVAGRGAARR YTALALRTIS  60
CQFRCLRDAI KKQIQAVQQS LGEHSTMPNG FTRLRYVDQQ LRQQRNLQQF GMLRQPWRPQ  120
RGLPETAVSI LRAWLFEHFL HPYPKDSEKI MLARQTGLSR SQVANWFINA RVRLWKPMIE  180
EMYKEEFGDI EGDSKSSELA QAVARLKSES EDAAGEELHE SSISATADAN QLRQSKKLSS  240
QDGSYEENAM NSESNKSWRN KIVNQTDDQS ITASIKPYEF SMLGGTRVSL ALGLQHSETN  300
PQSGIDGTAA SVGVDKADYF CIDAINQQDR FSNPHLLSDF VV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A4e-17123181563Homeobox protein Meis2
3k2a_B4e-17123181563Homeobox protein Meis2
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011083616.11e-122PREDICTED: BEL1-like homeodomain protein 7
RefseqXP_011083614.11e-122PREDICTED: BEL1-like homeodomain protein 7
RefseqXP_011083613.11e-122PREDICTED: BEL1-like homeodomain protein 7
SwissprotQ9FWS92e-82BLH3_ARATH; BEL1-like homeodomain protein 3
TrEMBLA0A068UFX51e-141A0A068UFX5_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000096101e-113(Solanum tuberosum)